Special Offers see all

More at Powell's

Interviews | Q&As | Essays

Textbooks

Textbooks
Networking

There are 116 books in this aisle.

Featured Titles in Textbooks - Networking
Page 1 of 6 next

$VAR1 = { 
 'blurb' => 'The Animation Bible is the first book any aspiring animator will want to own&#151;and with increasingly affordable tools for digital animation and the vast forum of the Internet for free distribution, animation is becoming more popular than ever', 
 'enter_date' => '2013-10-01', 
 'placement' => '1', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4467420', 
 'isbn' => '9780810995451', 
 'op_code' => '', 
 'publisher' => 'HNA Books', 
 'received_date' => '0', 
 'author_key' => 'furnissmaureen', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Animation Bible: a Practical Guide To the Art of Animating From Flipbooks To Flash (08 Edition)', 
 'price' => '17.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Maureen Furniss', 
 'section' => 'Networking-General', 
 'title_key' => 'animationbiblepracticalguideartanimatingflipbooksflash08edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.15', 
 'slipcase' => '', 
 'inkey' => '65-9780810995451-2', 
 'list_price' => '32.50', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780810995451' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4467420', 
 'isbn' => '9780810995451', 
 'op_code' => '', 
 'publisher' => 'HNA Books', 
 'received_date' => '0', 
 'author_key' => 'furnissmaureen', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Animation Bible: a Practical Guide To the Art of Animating From Flipbooks To Flash (08 Edition)', 
 'price' => '17.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Maureen Furniss', 
 'section' => 'Networking-General', 
 'title_key' => 'animationbiblepracticalguideartanimatingflipbooksflash08edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.15', 
 'slipcase' => '', 
 'inkey' => '65-9780810995451-2', 
 'list_price' => '32.50', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
};

Animation Bible: a Practical Guide To the Art of Animating From Flipbooks To Flash (08 Edition)
by Maureen Furniss
Publisher Comments
The Animation Bible is the first book any aspiring animator will want to own—and with increasingly affordable tools for digital animation and the vast forum of the Internet for free distribution, animation is becoming more popular than ever... (read more)

List Price $32.50
Your price: $17.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Adding sophisticated new tools that give modelers even more control over polygons, an already cool program just got even cooler. Here to take budding 3D artists from 0 to 60 fast in Maya 8 is the eagerly anticipated update to everybody&#39;s favorite', 
 'enter_date' => '2013-10-01', 
 'placement' => '2', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4387885', 
 'isbn' => '9780321476753', 
 'op_code' => '', 
 'publisher' => 'Peachpit Press', 
 'received_date' => '0', 
 'author_key' => 'robinsonandmorgansteinnathaniel', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Maya 8 for Windows and Macintosh : Visual Quickstart Guide (07 Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Robinson And Morgan / Stein / Nathaniel', 
 'section' => 'Networking-General', 
 'title_key' => 'maya8windowsmacintoshvisualquickstartguide07edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9780321476753-2', 
 'list_price' => '34.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780321476753' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4387885', 
 'isbn' => '9780321476753', 
 'op_code' => '', 
 'publisher' => 'Peachpit Press', 
 'received_date' => '0', 
 'author_key' => 'robinsonandmorgansteinnathaniel', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Maya 8 for Windows and Macintosh : Visual Quickstart Guide (07 Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Robinson And Morgan / Stein / Nathaniel', 
 'section' => 'Networking-General', 
 'title_key' => 'maya8windowsmacintoshvisualquickstartguide07edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9780321476753-2', 
 'list_price' => '34.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

Maya 8 for Windows and Macintosh : Visual Quickstart Guide (07 Edition)
by Robinson And Morgan / Stein / Nathaniel
Publisher Comments
Adding sophisticated new tools that give modelers even more control over polygons, an already cool program just got even cooler. Here to take budding 3D artists from 0 to 60 fast in Maya 8 is the eagerly anticipated update to everybody's favorite... (read more)

List Price $34.99
Your price: $18.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Create amazing animated effects such as fiery blazes, rippling water, and magical transformations. Animation guru Joseph Gilland breaks down the world of special effects animation with clear step-by-step diagrams and explanations on how to create the', 
 'enter_date' => '2013-10-01', 
 'placement' => '3', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375552', 
 'isbn' => '9780240811635', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'gillandjoseph', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Elemental Magic (09 Edition)', 
 'price' => '25.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Joseph Gilland', 
 'section' => 'Networking-General', 
 'title_key' => 'elementalmagic09edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '12.50', 
 'slipcase' => '', 
 'inkey' => '65-9780240811635-2', 
 'list_price' => '49.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780240811635' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375552', 
 'isbn' => '9780240811635', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'gillandjoseph', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Elemental Magic (09 Edition)', 
 'price' => '25.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Joseph Gilland', 
 'section' => 'Networking-General', 
 'title_key' => 'elementalmagic09edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '12.50', 
 'slipcase' => '', 
 'inkey' => '65-9780240811635-2', 
 'list_price' => '49.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

Elemental Magic (09 Edition)
by Joseph Gilland
Publisher Comments
Create amazing animated effects such as fiery blazes, rippling water, and magical transformations. Animation guru Joseph Gilland breaks down the world of special effects animation with clear step-by-step diagrams and explanations on how to create the... (read more)

List Price $49.95
Your price: $25.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'The definitive book on animation, from the Academy Award-winning animator behind Who Framed Roger Rabbit? Animation is one of the hottest areas of filmmaking today--and the master animator who bridges the old generation and the new is Richard Williams', 
 'enter_date' => '2013-10-01', 
 'placement' => '4', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4429832', 
 'isbn' => '9780571238347', 
 'op_code' => '', 
 'publisher' => 'Faber & Faber', 
 'received_date' => '0', 
 'author_key' => 'williamsrichard', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Animator\'s Survival Kit, Expanded ((Rev)09 - Old Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Richard Williams', 
 'section' => 'Networking-General', 
 'title_key' => 'animatorssurvivalkitexpandedrev09oldedition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9780571238347-2', 
 'list_price' => '35.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780571238347' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4429832', 
 'isbn' => '9780571238347', 
 'op_code' => '', 
 'publisher' => 'Faber & Faber', 
 'received_date' => '0', 
 'author_key' => 'williamsrichard', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Animator\'s Survival Kit, Expanded ((Rev)09 - Old Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Richard Williams', 
 'section' => 'Networking-General', 
 'title_key' => 'animatorssurvivalkitexpandedrev09oldedition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9780571238347-2', 
 'list_price' => '35.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

Animator's Survival Kit, Expanded ((Rev)09 - Old Edition)
by Richard Williams
Publisher Comments
The definitive book on animation, from the Academy Award-winning animator behind Who Framed Roger Rabbit? Animation is one of the hottest areas of filmmaking today--and the master animator who bridges the old generation and the new is Richard Williams... (read more)

List Price $35.00
Your price: $18.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => '&ldquo;For an engineer determined to refine and secure Internet operation or to explore alternative solutions to persistent problems, the insights provided by this book will be invaluable.&rdquo; &mdash;Vint Cerf, Internet pioneer &nbsp; TCP/IP', 
 'enter_date' => '2013-10-01', 
 'placement' => '5', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4387252', 
 'isbn' => '9780321336316', 
 'op_code' => '', 
 'publisher' => 'Addison-Wesley Professional', 
 'received_date' => '0', 
 'author_key' => 'stevenswrichard', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Tcp/ip Illustrated, Volume 1 : Protocols (2ND 12 Edition)', 
 'price' => '53.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'W. Richard Stevens', 
 'section' => 'Networking-General', 
 'title_key' => 'tcpipillustratedvolume1protocols2nd12edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '42.00', 
 'slipcase' => '', 
 'inkey' => '65-9780321336316-1', 
 'list_price' => '69.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '10', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780321336316' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4387252', 
 'isbn' => '9780321336316', 
 'op_code' => '', 
 'publisher' => 'Addison-Wesley Professional', 
 'received_date' => '0', 
 'author_key' => 'stevenswrichard', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Tcp/ip Illustrated, Volume 1 : Protocols (2ND 12 Edition)', 
 'price' => '53.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'W. Richard Stevens', 
 'section' => 'Networking-General', 
 'title_key' => 'tcpipillustratedvolume1protocols2nd12edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '42.00', 
 'slipcase' => '', 
 'inkey' => '65-9780321336316-1', 
 'list_price' => '69.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '10', 
 'notes' => '' 
};

Tcp/ip Illustrated, Volume 1 : Protocols (2ND 12 Edition)
by W. Richard Stevens
Publisher Comments
“For an engineer determined to refine and secure Internet operation or to explore alternative solutions to persistent problems, the insights provided by this book will be invaluable.” —Vint Cerf, Internet pioneer TCP/IP... (read more)

List Price $69.99
Your price: $53.00
Used - Hardcover

add to wish list

$VAR1 = { 
 'blurb' => 'The importance of computer graphics is spreading beyond the computer science discipline and graphics experts. With the ready availability of OpenGL on essentially all platforms, readers can learn to create effective images early on. Emphasizes the', 
 'enter_date' => '2013-10-01', 
 'placement' => '6', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4348027', 
 'isbn' => '9780131452541', 
 'op_code' => '', 
 'publisher' => 'Prentice Hall', 
 'received_date' => '0', 
 'author_key' => 'cunninghamsteve', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Computer Graphics : Programming in Opengl for Uisual Communication (07 Edition)', 
 'price' => '105.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steve Cunningham', 
 'section' => 'Networking-General', 
 'title_key' => 'computergraphicsprogrammingopengluisualcommunication07edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '83.90', 
 'slipcase' => '', 
 'inkey' => '65-9780131452541-1', 
 'list_price' => '131.10', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '4', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780131452541' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4348027', 
 'isbn' => '9780131452541', 
 'op_code' => '', 
 'publisher' => 'Prentice Hall', 
 'received_date' => '0', 
 'author_key' => 'cunninghamsteve', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Computer Graphics : Programming in Opengl for Uisual Communication (07 Edition)', 
 'price' => '105.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steve Cunningham', 
 'section' => 'Networking-General', 
 'title_key' => 'computergraphicsprogrammingopengluisualcommunication07edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '83.90', 
 'slipcase' => '', 
 'inkey' => '65-9780131452541-1', 
 'list_price' => '131.10', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '4', 
 'notes' => '' 
};

Computer Graphics : Programming in Opengl for Uisual Communication (07 Edition)
by Steve Cunningham
Publisher Comments
The importance of computer graphics is spreading beyond the computer science discipline and graphics experts. With the ready availability of OpenGL on essentially all platforms, readers can learn to create effective images early on. Emphasizes the... (read more)

List Price $131.10
Your price: $105.00
Used - Hardcover

add to wish list

$VAR1 = { 
 'blurb' => 'You want to make your websites more dynamic by adding a feedback form, creating a private area where members can upload images that are automatically resized, or perhaps storing all your content in a database. The problem is, you\'re not a programmer and', 
 'enter_date' => '2013-10-01', 
 'placement' => '7', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4524979', 
 'isbn' => '9781590597316', 
 'op_code' => '', 
 'publisher' => 'Friends of ED', 
 'received_date' => '0', 
 'author_key' => 'powersdavid', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Php Solutions : Dynamic Web Design Made Easy (06 - Old Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'David Powers', 
 'section' => 'Networking-General', 
 'title_key' => 'phpsolutionsdynamicwebdesignmadeeasy06oldedition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9781590597316-2', 
 'list_price' => '34.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '25', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781590597316' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4524979', 
 'isbn' => '9781590597316', 
 'op_code' => '', 
 'publisher' => 'Friends of ED', 
 'received_date' => '0', 
 'author_key' => 'powersdavid', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Php Solutions : Dynamic Web Design Made Easy (06 - Old Edition)', 
 'price' => '18.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'David Powers', 
 'section' => 'Networking-General', 
 'title_key' => 'phpsolutionsdynamicwebdesignmadeeasy06oldedition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.75', 
 'slipcase' => '', 
 'inkey' => '65-9781590597316-2', 
 'list_price' => '34.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '25', 
 'notes' => '' 
};

Php Solutions : Dynamic Web Design Made Easy (06 - Old Edition)
by David Powers
Publisher Comments
You want to make your websites more dynamic by adding a feedback form, creating a private area where members can upload images that are automatically resized, or perhaps storing all your content in a database. The problem is, you're not a programmer and... (read more)

List Price $34.99
Your price: $18.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Welcome to the Discreet Official Training Courseware for 3ds max 7 software! Consider this book an all-access pass to the production and training experience of Discreet developers and training experts. Written for self-paced learning or instructor-led', 
 'enter_date' => '2013-10-01', 
 'placement' => '8', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375468', 
 'isbn' => '9780240807393', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'discreetpublishingstaff', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Fundamentals and Beyond Courseware 3DS Max 7 -with CD (04 Edition)', 
 'price' => '29.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Discreet Publishing Staff', 
 'section' => 'Networking-General', 
 'title_key' => 'fundamentalsbeyondcourseware3dsmax7cd04edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '15.00', 
 'slipcase' => '', 
 'inkey' => '65-9780240807393-2', 
 'list_price' => '59.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '13', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780240807393' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375468', 
 'isbn' => '9780240807393', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'discreetpublishingstaff', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Fundamentals and Beyond Courseware 3DS Max 7 -with CD (04 Edition)', 
 'price' => '29.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Discreet Publishing Staff', 
 'section' => 'Networking-General', 
 'title_key' => 'fundamentalsbeyondcourseware3dsmax7cd04edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '15.00', 
 'slipcase' => '', 
 'inkey' => '65-9780240807393-2', 
 'list_price' => '59.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '13', 
 'notes' => '' 
};

Fundamentals and Beyond Courseware 3DS Max 7 -with CD (04 Edition)
by Discreet Publishing Staff
Publisher Comments
Welcome to the Discreet Official Training Courseware for 3ds max 7 software! Consider this book an all-access pass to the production and training experience of Discreet developers and training experts. Written for self-paced learning or instructor-led... (read more)

List Price $59.95
Your price: $29.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Texturing: Concepts and Techniques is about the aesthetics and design issues of creating and using interesting textures for digital 3D animation. This beautifully illustrated, full color book teaches artists how to create stunning and convincing textures', 
 'enter_date' => '2013-10-01', 
 'placement' => '9', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4522405', 
 'isbn' => '9781584503002', 
 'op_code' => '', 
 'publisher' => 'Charles River Media', 
 'received_date' => '0', 
 'author_key' => 'summersdennis', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Texturing : Concepts and Techniques - With CD (04 Edition)', 
 'price' => '42.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Dennis Summers', 
 'section' => 'Networking-General', 
 'title_key' => 'texturingconceptstechniquescd04edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '33.00', 
 'slipcase' => '', 
 'inkey' => '65-9781584503002-1', 
 'list_price' => '54.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781584503002' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4522405', 
 'isbn' => '9781584503002', 
 'op_code' => '', 
 'publisher' => 'Charles River Media', 
 'received_date' => '0', 
 'author_key' => 'summersdennis', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Texturing : Concepts and Techniques - With CD (04 Edition)', 
 'price' => '42.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Dennis Summers', 
 'section' => 'Networking-General', 
 'title_key' => 'texturingconceptstechniquescd04edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '33.00', 
 'slipcase' => '', 
 'inkey' => '65-9781584503002-1', 
 'list_price' => '54.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
};

Texturing : Concepts and Techniques - With CD (04 Edition)
by Dennis Summers
Publisher Comments
Texturing: Concepts and Techniques is about the aesthetics and design issues of creating and using interesting textures for digital 3D animation. This beautifully illustrated, full color book teaches artists how to create stunning and convincing textures... (read more)

List Price $54.95
Your price: $42.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Breathe life into your animations with this essential guide to Maya 2010. Packed with classic animation techniques and the secrets of professional animators, How to Cheat in Maya 2010 provides productivity tips and tricks to help you get things done in', 
 'enter_date' => '2013-10-01', 
 'placement' => '10', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-MULTIMEDIA', 
 'binding' => 'Trade Paper', 
 'copyright' => '2010', 
 'online_only' => '0', 
 'xeno_id' => '220C', 
 'dustjacket' => '', 
 'id' => '2989332', 
 'isbn' => '9780240811888', 
 'op_code' => 'YE', 
 'publisher' => 'Focal Press', 
 'received_date' => '20120531', 
 'author_key' => 'luhtaeric', 
 'bookscape_id' => '14602552', 
 'sold_out' => '0', 
 'title' => 'How to Cheat in Maya 2010: Tools and Techniques for the Maya Animator (How to Cheat in)', 
 'price' => '13.50', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Eric Luhta', 
 'section' => 'Multimedia-General', 
 'title_key' => 'howcheatmaya2010toolstechniquesmayaanimatorhowcheat', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '3.75', 
 'slipcase' => '', 
 'inkey' => '7-9780240811888-0', 
 'list_price' => '44.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '7', 
 'sectionkey' => 'MultimediaGeneral', 
 'create_date' => '20120531', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780240811888' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-MULTIMEDIA', 
 'binding' => 'Trade Paper', 
 'copyright' => '2010', 
 'online_only' => '0', 
 'xeno_id' => '220C', 
 'dustjacket' => '', 
 'id' => '2989332', 
 'isbn' => '9780240811888', 
 'op_code' => 'YE', 
 'publisher' => 'Focal Press', 
 'received_date' => '20120531', 
 'author_key' => 'luhtaeric', 
 'bookscape_id' => '14602552', 
 'sold_out' => '0', 
 'title' => 'How to Cheat in Maya 2010: Tools and Techniques for the Maya Animator (How to Cheat in)', 
 'price' => '13.50', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Eric Luhta', 
 'section' => 'Multimedia-General', 
 'title_key' => 'howcheatmaya2010toolstechniquesmayaanimatorhowcheat', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '3.75', 
 'slipcase' => '', 
 'inkey' => '7-9780240811888-0', 
 'list_price' => '44.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '7', 
 'sectionkey' => 'MultimediaGeneral', 
 'create_date' => '20120531', 
 'qty' => '1', 
 'notes' => '' 
};

How to Cheat in Maya 2010: Tools and Techniques for the Maya Animator (How to Cheat in)
by Eric Luhta
Publisher Comments
Breathe life into your animations with this essential guide to Maya 2010. Packed with classic animation techniques and the secrets of professional animators, How to Cheat in Maya 2010 provides productivity tips and tricks to help you get things done in... (read more)

List Price $44.95
Your price: $13.50
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'The third edition of this book continues to focus on the 3D aspects of computer graphics, and reflects the growing demand for real-time applications such as games and virtual reality. It also includes new material on Visualization in Scientific Computing', 
 'enter_date' => '2013-10-01', 
 'placement' => '11', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'TEXTBOOKS', 
 'binding' => 'Hardcover', 
 'copyright' => '1999', 
 'online_only' => '0', 
 'xeno_id' => '545Q4', 
 'dustjacket' => '', 
 'id' => '3164952', 
 'isbn' => '9780201398557', 
 'op_code' => 'YE', 
 'publisher' => 'Addison Wesley Publishing Company', 
 'received_date' => '20130130', 
 'author_key' => 'wattalan', 
 'bookscape_id' => '15311082', 
 'sold_out' => '0', 
 'title' => '3D Computer Graphics with CDROM', 
 'price' => '30.00', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Alan Watt', 
 'section' => 'Textbooks-General', 
 'title_key' => '3dcomputergraphicscdrom', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '7.00', 
 'slipcase' => '', 
 'inkey' => '17-9780201398557-2', 
 'list_price' => '76.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '17', 
 'sectionkey' => 'TextbooksGeneral', 
 'create_date' => '20130130', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780201398557' 
}; 
$VAR1 = { 
 'sq1_section' => 'TEXTBOOKS', 
 'binding' => 'Hardcover', 
 'copyright' => '1999', 
 'online_only' => '0', 
 'xeno_id' => '545Q4', 
 'dustjacket' => '', 
 'id' => '3164952', 
 'isbn' => '9780201398557', 
 'op_code' => 'YE', 
 'publisher' => 'Addison Wesley Publishing Company', 
 'received_date' => '20130130', 
 'author_key' => 'wattalan', 
 'bookscape_id' => '15311082', 
 'sold_out' => '0', 
 'title' => '3D Computer Graphics with CDROM', 
 'price' => '30.00', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Alan Watt', 
 'section' => 'Textbooks-General', 
 'title_key' => '3dcomputergraphicscdrom', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '7.00', 
 'slipcase' => '', 
 'inkey' => '17-9780201398557-2', 
 'list_price' => '76.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '17', 
 'sectionkey' => 'TextbooksGeneral', 
 'create_date' => '20130130', 
 'qty' => '1', 
 'notes' => '' 
};

3D Computer Graphics with CDROM
by Alan Watt
Publisher Comments
The third edition of this book continues to focus on the 3D aspects of computer graphics, and reflects the growing demand for real-time applications such as games and virtual reality. It also includes new material on Visualization in Scientific Computing... (read more)

List Price $76.00
Your price: $30.00
Used - Hardcover

add to wish list

$VAR1 = { 
 'blurb' => '3D GAME PROGRAMMING ALL IN ONE, THIRD EDITION is perfect for anyone interested in learning the skills and processes involved in making 3D games. This new edition of the bestselling book shows you how to design and create every aspect of a fully featured', 
 'enter_date' => '2013-10-01', 
 'placement' => '12', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4507337', 
 'isbn' => '9781435457447', 
 'op_code' => '', 
 'publisher' => 'Course Technology', 
 'received_date' => '0', 
 'author_key' => 'finneykennethc', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => '3d Game Programming All in One (3RD 12 Edition)', 
 'price' => '45.50', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Kenneth C Finney', 
 'section' => 'Networking-General', 
 'title_key' => '3dgameprogrammingallone3rd12edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '36.00', 
 'slipcase' => '', 
 'inkey' => '65-9781435457447-1', 
 'list_price' => '59.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781435457447' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4507337', 
 'isbn' => '9781435457447', 
 'op_code' => '', 
 'publisher' => 'Course Technology', 
 'received_date' => '0', 
 'author_key' => 'finneykennethc', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => '3d Game Programming All in One (3RD 12 Edition)', 
 'price' => '45.50', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Kenneth C Finney', 
 'section' => 'Networking-General', 
 'title_key' => '3dgameprogrammingallone3rd12edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '36.00', 
 'slipcase' => '', 
 'inkey' => '65-9781435457447-1', 
 'list_price' => '59.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '2', 
 'notes' => '' 
};

3d Game Programming All in One (3RD 12 Edition)
by Kenneth C Finney
Publisher Comments
3D GAME PROGRAMMING ALL IN ONE, THIRD EDITION is perfect for anyone interested in learning the skills and processes involved in making 3D games. This new edition of the bestselling book shows you how to design and create every aspect of a fully featured... (read more)

List Price $59.99
Your price: $45.50
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Pro OGRE 3D Programming is the detailed guide to utilizing the OGRE (Object-Oriented Graphics Rendering Engine) 3D engine. OGRE, runs on all platforms and provides an object oriented interface to render 3D scenes, independent of the implementation such', 
 'enter_date' => '2013-10-01', 
 'placement' => '13', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4524978', 
 'isbn' => '9781590597101', 
 'op_code' => '', 
 'publisher' => 'Apress', 
 'received_date' => '0', 
 'author_key' => 'junkergregory', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Pro Ogre 3D Programming (06 Edition)', 
 'price' => '27.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Gregory Junker', 
 'section' => 'Networking-General', 
 'title_key' => 'proogre3dprogramming06edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '13.75', 
 'slipcase' => '', 
 'inkey' => '65-9781590597101-2', 
 'list_price' => '54.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781590597101' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4524978', 
 'isbn' => '9781590597101', 
 'op_code' => '', 
 'publisher' => 'Apress', 
 'received_date' => '0', 
 'author_key' => 'junkergregory', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Pro Ogre 3D Programming (06 Edition)', 
 'price' => '27.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Gregory Junker', 
 'section' => 'Networking-General', 
 'title_key' => 'proogre3dprogramming06edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '13.75', 
 'slipcase' => '', 
 'inkey' => '65-9781590597101-2', 
 'list_price' => '54.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

Pro Ogre 3D Programming (06 Edition)
by Gregory Junker
Publisher Comments
Pro OGRE 3D Programming is the detailed guide to utilizing the OGRE (Object-Oriented Graphics Rendering Engine) 3D engine. OGRE, runs on all platforms and provides an object oriented interface to render 3D scenes, independent of the implementation such... (read more)

List Price $54.99
Your price: $27.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Thoroughly revised, this third edition focuses on modern techniques used to generate synthetic three-dimensional images in a fraction of a second. With the advent of programmable shaders, a wide variety of new algorithms have arisen and evolved over the', 
 'enter_date' => '2013-10-01', 
 'placement' => '14', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4517285', 
 'isbn' => '9781568814247', 
 'op_code' => '', 
 'publisher' => 'AK Peters', 
 'received_date' => '0', 
 'author_key' => 'akeninemollertomas', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Real-time Rendering (3RD 09 Edition)', 
 'price' => '67.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Tomas Akenine-moller', 
 'section' => 'Networking-General', 
 'title_key' => 'realtimerendering3rd09edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '53.40', 
 'slipcase' => '', 
 'inkey' => '65-9781568814247-1', 
 'list_price' => '89.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Synopsis', 
 'isbn' => '9781568814247' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4517285', 
 'isbn' => '9781568814247', 
 'op_code' => '', 
 'publisher' => 'AK Peters', 
 'received_date' => '0', 
 'author_key' => 'akeninemollertomas', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Real-time Rendering (3RD 09 Edition)', 
 'price' => '67.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Tomas Akenine-moller', 
 'section' => 'Networking-General', 
 'title_key' => 'realtimerendering3rd09edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '53.40', 
 'slipcase' => '', 
 'inkey' => '65-9781568814247-1', 
 'list_price' => '89.00', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

Real-time Rendering (3RD 09 Edition)
by Tomas Akenine-moller
Synopsis
Thoroughly revised, this third edition focuses on modern techniques used to generate synthetic three-dimensional images in a fraction of a second. With the advent of programmable shaders, a wide variety of new algorithms have arisen and evolved over the... (read more)

List Price $89.00
Your price: $67.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Includes companion DVD with trial versions of LightWave v9.2 Essential LightWave v9 offers an unparalleled guide to LightWave 3D. Written to help users quickly take control of the software, this book is filled with easy-to-understand explanations, time', 
 'enter_date' => '2013-10-01', 
 'placement' => '15', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'MULTI-ANIMATION18', 
 'binding' => 'Trade Paper', 
 'copyright' => '2007', 
 'online_only' => '0', 
 'xeno_id' => '18', 
 'dustjacket' => '', 
 'id' => '1583762', 
 'isbn' => '9781598220247', 
 'op_code' => 'YE', 
 'publisher' => 'Wordware Publishing', 
 'received_date' => '20120731', 
 'author_key' => 'warnersteve', 
 'bookscape_id' => '14784062', 
 'sold_out' => '0', 
 'title' => 'Essential Lightwave V9 the Fastest & Easiest Way To Master Lightwave 3D', 
 'price' => '33.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steve Warner', 
 'section' => 'Multimedia-Animation', 
 'title_key' => 'essentiallightwavev9fastesteasiestwaymasterlightwave3d', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '5.00', 
 'slipcase' => '', 
 'inkey' => '1-9781598220247-2', 
 'list_price' => '58.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '1', 
 'sectionkey' => 'MultimediaAnimation', 
 'create_date' => '20120730', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781598220247' 
}; 
$VAR1 = { 
 'sq1_section' => 'MULTI-ANIMATION18', 
 'binding' => 'Trade Paper', 
 'copyright' => '2007', 
 'online_only' => '0', 
 'xeno_id' => '18', 
 'dustjacket' => '', 
 'id' => '1583762', 
 'isbn' => '9781598220247', 
 'op_code' => 'YE', 
 'publisher' => 'Wordware Publishing', 
 'received_date' => '20120731', 
 'author_key' => 'warnersteve', 
 'bookscape_id' => '14784062', 
 'sold_out' => '0', 
 'title' => 'Essential Lightwave V9 the Fastest & Easiest Way To Master Lightwave 3D', 
 'price' => '33.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steve Warner', 
 'section' => 'Multimedia-Animation', 
 'title_key' => 'essentiallightwavev9fastesteasiestwaymasterlightwave3d', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '5.00', 
 'slipcase' => '', 
 'inkey' => '1-9781598220247-2', 
 'list_price' => '58.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '1', 
 'sectionkey' => 'MultimediaAnimation', 
 'create_date' => '20120730', 
 'qty' => '1', 
 'notes' => '' 
};

Essential Lightwave V9 the Fastest & Easiest Way To Master Lightwave 3D
by Steve Warner
Publisher Comments
Includes companion DVD with trial versions of LightWave v9.2 Essential LightWave v9 offers an unparalleled guide to LightWave 3D. Written to help users quickly take control of the software, this book is filled with easy-to-understand explanations, time... (read more)

List Price $58.95
Your price: $33.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Create high-quality animations at little to no cost! The fun and easy way&#174; to film in a virtual world and get your movie noticed Want to master Machinima? This friendly, hands-on guide is packed with savvy techniques for movie-making in Machinima\'s', 
 'enter_date' => '2013-10-01', 
 'placement' => '16', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'MULTI-ANIMATION18', 
 'binding' => 'Trade Paper', 
 'copyright' => '2007', 
 'online_only' => '0', 
 'xeno_id' => '18', 
 'dustjacket' => '', 
 'id' => '1568395', 
 'isbn' => '9780470096918', 
 'op_code' => 'YE', 
 'publisher' => 'For Dummies', 
 'received_date' => '20111007', 
 'author_key' => 'hancockhugh', 
 'bookscape_id' => '13933467', 
 'sold_out' => '0', 
 'title' => 'Machinima for Dummies with DVD (For Dummies)', 
 'price' => '4.95', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Hugh Hancock', 
 'section' => 'Multimedia-Animation', 
 'title_key' => 'machinimadummiesdvddummies', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '4.00', 
 'slipcase' => '', 
 'inkey' => '1-9780470096918-2', 
 'list_price' => '29.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '1', 
 'sectionkey' => 'MultimediaAnimation', 
 'create_date' => '20111003', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780470096918' 
}; 
$VAR1 = { 
 'sq1_section' => 'MULTI-ANIMATION18', 
 'binding' => 'Trade Paper', 
 'copyright' => '2007', 
 'online_only' => '0', 
 'xeno_id' => '18', 
 'dustjacket' => '', 
 'id' => '1568395', 
 'isbn' => '9780470096918', 
 'op_code' => 'YE', 
 'publisher' => 'For Dummies', 
 'received_date' => '20111007', 
 'author_key' => 'hancockhugh', 
 'bookscape_id' => '13933467', 
 'sold_out' => '0', 
 'title' => 'Machinima for Dummies with DVD (For Dummies)', 
 'price' => '4.95', 
 'class' => 'USED MARKDOWN', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Hugh Hancock', 
 'section' => 'Multimedia-Animation', 
 'title_key' => 'machinimadummiesdvddummies', 
 'condition_code' => 'G', 
 'preorder' => '0', 
 'COG' => '4.00', 
 'slipcase' => '', 
 'inkey' => '1-9780470096918-2', 
 'list_price' => '29.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '1', 
 'sectionkey' => 'MultimediaAnimation', 
 'create_date' => '20111003', 
 'qty' => '1', 
 'notes' => '' 
};

Machinima for Dummies with DVD (For Dummies)
by Hugh Hancock
Publisher Comments
Create high-quality animations at little to no cost! The fun and easy way® to film in a virtual world and get your movie noticed Want to master Machinima? This friendly, hands-on guide is packed with savvy techniques for movie-making in Machinima's... (read more)

List Price $29.99
Your price: $4.95
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'An exceptionally practical and project-driven book, Exploring 3D Modeling with 3ds max 7 is written specifically for designers interested in exploring the concepts and technology of modeling. The book offers a thorough introduction to 3D design', 
 'enter_date' => '2013-10-01', 
 'placement' => '17', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4498024', 
 'isbn' => '9781401871093', 
 'op_code' => '', 
 'publisher' => 'Delmar Thomson Learning', 
 'received_date' => '0', 
 'author_key' => 'tillsteven', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => '3d Modeling 3DS Max 7 - With CD (05 Edition)', 
 'price' => '48.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steven Till', 
 'section' => 'Networking-General', 
 'title_key' => '3dmodeling3dsmax7cd05edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '37.80', 
 'slipcase' => '', 
 'inkey' => '65-9781401871093-1', 
 'list_price' => '59.10', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9781401871093' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4498024', 
 'isbn' => '9781401871093', 
 'op_code' => '', 
 'publisher' => 'Delmar Thomson Learning', 
 'received_date' => '0', 
 'author_key' => 'tillsteven', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => '3d Modeling 3DS Max 7 - With CD (05 Edition)', 
 'price' => '48.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Steven Till', 
 'section' => 'Networking-General', 
 'title_key' => '3dmodeling3dsmax7cd05edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '37.80', 
 'slipcase' => '', 
 'inkey' => '65-9781401871093-1', 
 'list_price' => '59.10', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

3d Modeling 3DS Max 7 - With CD (05 Edition)
by Steven Till
Publisher Comments
An exceptionally practical and project-driven book, Exploring 3D Modeling with 3ds max 7 is written specifically for designers interested in exploring the concepts and technology of modeling. The book offers a thorough introduction to 3D design... (read more)

List Price $59.10
Your price: $48.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'Got a digital camera, basic software, and a computer? Youre good to go! &#8226; A complete toolbox for creating 2D and stop-motion movies &#8226; Includes ready-to-scan templates plus tips, shortcuts, and more &#8226; Great for YouTube fans and everyone', 
 'enter_date' => '2013-10-01', 
 'placement' => '18', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4475241', 
 'isbn' => '9780823099221', 
 'op_code' => '', 
 'publisher' => 'Watson-Guptill Publications', 
 'received_date' => '0', 
 'author_key' => 'murphymary', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Beginner\'s Guide To Animation (08 Edition)', 
 'price' => '12.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Mary Murphy', 
 'section' => 'Networking-General', 
 'title_key' => 'beginnersguideanimation08edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '5.75', 
 'slipcase' => '', 
 'inkey' => '65-9780823099221-2', 
 'list_price' => '22.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '5', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780823099221' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4475241', 
 'isbn' => '9780823099221', 
 'op_code' => '', 
 'publisher' => 'Watson-Guptill Publications', 
 'received_date' => '0', 
 'author_key' => 'murphymary', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Beginner\'s Guide To Animation (08 Edition)', 
 'price' => '12.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Mary Murphy', 
 'section' => 'Networking-General', 
 'title_key' => 'beginnersguideanimation08edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '5.75', 
 'slipcase' => '', 
 'inkey' => '65-9780823099221-2', 
 'list_price' => '22.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '5', 
 'notes' => '' 
};

Beginner's Guide To Animation (08 Edition)
by Mary Murphy
Publisher Comments
Got a digital camera, basic software, and a computer? Youre good to go! • A complete toolbox for creating 2D and stop-motion movies • Includes ready-to-scan templates plus tips, shortcuts, and more • Great for YouTube fans and everyone... (read more)

List Price $22.95
Your price: $12.00
Used - Trade Paper

add to wish list

$VAR1 = { 
 'blurb' => 'In this best-selling guide to Motion 4, you\'ll create eight sophisticated projects including a 3D show promo, a network-style title sequence, a DVD motion menu, and an actual temp effect used in Overture Film\'s Traitor. Each chapter represents a complete', 
 'enter_date' => '2013-10-01', 
 'placement' => '19', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4388883', 
 'isbn' => '9780321635297', 
 'op_code' => '', 
 'publisher' => 'Peachpit Press', 
 'received_date' => '0', 
 'author_key' => 'spencermark', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Apple Pro Training Series: Motion 4 - With DVD (2ND 10 Edition)', 
 'price' => '27.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Mark Spencer', 
 'section' => 'Networking-General', 
 'title_key' => 'appleprotrainingseriesmotion4dvd2nd10edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '13.75', 
 'slipcase' => '', 
 'inkey' => '65-9780321635297-2', 
 'list_price' => '54.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '3', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780321635297' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Hardcover', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4388883', 
 'isbn' => '9780321635297', 
 'op_code' => '', 
 'publisher' => 'Peachpit Press', 
 'received_date' => '0', 
 'author_key' => 'spencermark', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'Apple Pro Training Series: Motion 4 - With DVD (2ND 10 Edition)', 
 'price' => '27.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Mark Spencer', 
 'section' => 'Networking-General', 
 'title_key' => 'appleprotrainingseriesmotion4dvd2nd10edition', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '13.75', 
 'slipcase' => '', 
 'inkey' => '65-9780321635297-2', 
 'list_price' => '54.99', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '3', 
 'notes' => '' 
};

Apple Pro Training Series: Motion 4 - With DVD (2ND 10 Edition)
by Mark Spencer
Publisher Comments
In this best-selling guide to Motion 4, you'll create eight sophisticated projects including a 3D show promo, a network-style title sequence, a DVD motion menu, and an actual temp effect used in Overture Film's Traitor. Each chapter represents a complete... (read more)

List Price $54.99
Your price: $27.00
Used - Hardcover

add to wish list

$VAR1 = { 
 'blurb' => 'After Effects (a motion graphics and visual effects software package that\'s used frequently in video, film, DVD and on the web) used, for example to create the graphics you see on TV such as, the statistics tables for Wimbledon, or football. Quite often', 
 'enter_date' => '2013-10-01', 
 'placement' => '20', 
 'section_url' => 'TextbooksNetworking', 
 'section' => 'Textbooks-Networking', 
 'stock' => { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375366', 
 'isbn' => '9780240519685', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'sponslercurtis', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'The Focal Easy Guide To After Effects', 
 'price' => '17.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Curtis Sponsler', 
 'section' => 'Networking-General', 
 'title_key' => 'focaleasyguideaftereffects', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.25', 
 'slipcase' => '', 
 'inkey' => '65-9780240519685-2', 
 'list_price' => '32.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
 }, 
 'has_blurb' => '1', 
 'img_maybe' => '1', 
 'sub' => undef, 
 'type' => 'Publisher Comments', 
 'isbn' => '9780240519685' 
}; 
$VAR1 = { 
 'sq1_section' => 'CP-NETWK NETWORK', 
 'binding' => 'Trade Paper', 
 'copyright' => '0', 
 'online_only' => '1', 
 'xeno_id' => '', 
 'dustjacket' => '', 
 'id' => '4375366', 
 'isbn' => '9780240519685', 
 'op_code' => '', 
 'publisher' => 'Focal Press', 
 'received_date' => '0', 
 'author_key' => 'sponslercurtis', 
 'bookscape_id' => '0', 
 'sold_out' => '0', 
 'title' => 'The Focal Easy Guide To After Effects', 
 'price' => '17.00', 
 'class' => 'USED', 
 'attributes' => '0', 
 'COG_basis' => '0.00', 
 'author' => 'Curtis Sponsler', 
 'section' => 'Networking-General', 
 'title_key' => 'focaleasyguideaftereffects', 
 'condition_code' => 'SO', 
 'preorder' => '0', 
 'COG' => '8.25', 
 'slipcase' => '', 
 'inkey' => '65-9780240519685-2', 
 'list_price' => '32.95', 
 'class_external' => 'Used', 
 'newly_arrived' => '0', 
 'store' => '65', 
 'sectionkey' => 'NetworkingGeneral', 
 'create_date' => '0', 
 'qty' => '1', 
 'notes' => '' 
};

The Focal Easy Guide To After Effects
by Curtis Sponsler
Publisher Comments
After Effects (a motion graphics and visual effects software package that's used frequently in video, film, DVD and on the web) used, for example to create the graphics you see on TV such as, the statistics tables for Wimbledon, or football. Quite often... (read more)

List Price $32.95
Your price: $17.00
Used - Trade Paper

add to wish list

1 2 3 4 5 6 next»

There are 116 books in this aisle.

This way to more aisles in Textbooks

Follow us on...

RSS 2.0
Log Off

Powell's City of Books is an independent bookstore in Portland, Oregon, that fills a whole city block with more than a million new, used, and out of print books. Shop those shelves — plus literally millions more books, DVDs, and eBooks — here at Powells.com.

Special Offers see all

Enter to WIN!

More at Powell's

Textbooks

Textbooks Networking

Textbooks
Networking